LOCUS       a                        730 bp    mRNA    linear   ROD 07-JAN-2002
DEFINITION  Mus musculus nonagouti (a), mRNA.
ACCESSION   NM_015770
VERSION     NM_015770.1  GI:13929209
KEYWORDS    .
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus.
REFERENCE   1  (bases 1 to 730)
  AUTHORS   Bultman,S.J., Michaud,E.J. and Woychik,R.P.
  TITLE     Molecular characterization of the mouse agouti locus
  JOURNAL   Cell 71 (7), 1195-1204 (1992)
  MEDLINE   93113687
   PUBMED   1473152
REFERENCE   2  (bases 1 to 730)
  AUTHORS   Miller,M.W., Duhl,D.M., Vrieling,H., Cordes,S.P., Ollmann,M.M.,
            Winkes,B.M. and Barsh,G.S.
  TITLE     Cloning of the mouse agouti gene predicts a secreted protein
            ubiquitously expressed in mice carrying the lethal yellow mutation
  JOURNAL   Genes Dev. 7 (3), 454-467 (1993)
  MEDLINE   93194064
   PUBMED   8449404
REFERENCE   3  (bases 1 to 730)
  AUTHORS   Michaud,E.J., Bultman,S.J., Stubbs,L.J. and Woychik,R.P.
  TITLE     The embryonic lethality of homozygous lethal yellow mice (Ay/Ay) is
            associated with the disruption of a novel RNA-binding protein
  JOURNAL   Genes Dev. 7 (7A), 1203-1213 (1993)
  MEDLINE   93307655
   PUBMED   8319910
REFERENCE   4  (bases 1 to 730)
  AUTHORS   Bultman,S.J., Klebig,M.L., Michaud,E.J., Sweet,H.O., Davisson,M.T.
            and Woychik,R.P.
  TITLE     Molecular analysis of reverse mutations from nonagouti (a) to
            black-and-tan (a(t)) and white-bellied agouti (Aw) reveals
            alternative forms of agouti transcripts
  JOURNAL   Genes Dev. 8 (4), 481-490 (1994)
  MEDLINE   94170992
   PUBMED   8125260
REFERENCE   5  (bases 1 to 730)
  AUTHORS   Michaud,E.J., van Vugt,M.J., Bultman,S.J., Sweet,H.O.,
            Davisson,M.T. and Woychik,R.P.
  TITLE     Differential expression of a new dominant agouti allele (Aiapy) is
            correlated with methylation state and is influenced by parental
            lineage
  JOURNAL   Genes Dev. 8 (12), 1463-1472 (1994)
  MEDLINE   95011556
   PUBMED   7926745
REFERENCE   6  (bases 1 to 730)
  AUTHORS   Carninci,P., Shibata,Y., Hayatsu,N., Sugahara,Y., Shibata,K.,
            Itoh,M., Konno,H., Okazaki,Y., Muramatsu,M. and Hayashizaki,Y.
  TITLE     Normalization and subtraction of cap-trapper-selected cDNAs to
            prepare full-length cDNA libraries for rapid discovery of new genes
  JOURNAL   Genome Res. 10 (10), 1617-1630 (2000)
  MEDLINE   20499374
   PUBMED   11042159
REFERENCE   7  (bases 1 to 730)
  AUTHORS   Shibata,K., Itoh,M., Aizawa,K., Nagaoka,S., Sasaki,N., Carninci,P.,
            Konno,H., Akiyama,J., Nishi,K., Kitsunai,T., Tashiro,H., Itoh,M.,
            Sumi,N., Ishii,Y., Nakamura,S., Hazama,M., Nishine,T., Harada,A.,
            Yamamoto,R., Matsumoto,H., Sakaguchi,S., Ikegami,T., Kashiwagi,K.,
            Fujiwake,S., Inoue,K. and Togawa,Y.
  TITLE     RIKEN integrated sequence analysis (RISA) system--384-format
            sequencing pipeline with 384 multicapillary sequencer
  JOURNAL   Genome Res. 10 (11), 1757-1771 (2000)
  MEDLINE   20530913
   PUBMED   11076861
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from L06451.1.
FEATURES             Location/Qualifiers
     source          1..730
                     /organism="Mus musculus"
                     /db_xref="taxon:10090"
                     /chromosome="2"
                     /map="2 89.0 cM"
                     /tissue_type="skin"
     gene            1..730
                     /gene="a"
                     /note="synonyms: agouti, As, ASIP"
                     /db_xref="LocusID:50518"
                     /db_xref="MGI:87853"
     CDS             122..517
                     /gene="a"
                     /note="non-agouti; agouti signal protein"
                     /codon_start=1
                     /product="nonagouti"
                     /protein_id="NP_056585.1"
                     /db_xref="GI:13929210"
                     /db_xref="LocusID:50518"
                     /db_xref="MGI:87853"
                     /translation="MDVTRLLLATLVSFLCFFTVHSHLALEETLGDDRSLRSNSSMNS
                     LDFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPP
                     APACCDPCASCQCRFFGSACTCRVLNPNC"
     variation       652
                     /gene="a"
                     /allele="G"
                     /allele="T"
                     /db_xref="dbSNP:3090503"
     polyA_site      730
                     /gene="a"
BASE COUNT      153 a    206 c    207 g    164 t
ORIGIN      
        1 tttaaaaatg tctcacagca atgctccttg cctctgccat tcaaggacag gaaagacatt
       61 ctggcctggc ttcccttagg ggagctgatg cggaatagag tcacttgtgc tgcttctcag
      121 gatggatgtc acccgcctac tcctggccac cctagtgagc ttcctgtgct tcttcaccgt
      181 ccacagccac ctggcactcg aggagacgct tggagatgac aggagtctgc ggagtaactc
      241 ctccatgaac tcgctggatt tctcctctgt ttctatcgtg gcactgaaca agaaatccaa
      301 gaagatcagc agaaaagaag ccgagaagcg gaagaggtct tccaagaaaa aggcttcgat
      361 gaagaaggtg gcaaggcccc cgccaccttc gccctgcgtg gccacccgcg acagctgcaa
      421 gccacccgca cccgcctgct gcgacccgtg cgcctcctgc cagtgccgtt tcttcggcag
      481 cgcctgcacc tgtcgagtac tcaaccccaa ctgctgacgc agcttcttcg ctgcgcgcgc
      541 agcttcggga acgggtgatt gggcggggct tcagggtccc gcgcttctag gctgaggggc
      601 gggtctctgt gggtggggct tgtgggtggg cgtggtcagt ggttgtgact tgtgggcgct
      661 ttcaaaaaac cggttttcta ggaaacctag tggaagctaa aatcagaata caataatatt
      721 tttaggctgc
//